Adsense Large Leaderboard

Monday, May 12, 2014

Season 3 End Sequence 3x22

Elsa Frozen 3x22 animatedfilmreviews.filminspector.com




Well, we had a new character introduced in the very end scene of the final episode of Season 3, and guess who it is?

Actually, it's not difficult to guess at all, so might as tell you (stop reading now if you don't want to know).

It's Elsa from "Frozen" emerging from a bottle and showing off her powers. No word yet on who will play her next season (or anyone else, for that matter).

We'll be back next year to cover all the new episodes of "Once Upon a Time," Season 4.
















No comments:

Post a Comment