Monday, May 12, 2014

Season 3 End Sequence 3x22

Elsa Frozen 3x22 animatedfilmreviews.filminspector.com




Well, we had a new character introduced in the very end scene of the final episode of Season 3, and guess who it is?

Actually, it's not difficult to guess at all, so might as tell you (stop reading now if you don't want to know).

It's Elsa from "Frozen" emerging from a bottle and showing off her powers. No word yet on who will play her next season (or anyone else, for that matter).

We'll be back next year to cover all the new episodes of "Once Upon a Time," Season 4.
















Thursday, May 8, 2014

ABC Press Release Season 3 Finale 3x21 3x22

Season 3 finale 3x21 3x22 onceuponatimeabc.filminspector.com

Monday, May 05, 2014
ABC Television Network
PRESS RELEASE - PRESS RELEASE - -
ON THE TWO-HOUR SEASON FINALE OF ABC'S "ONCE UPON A TIME"

SEASON FINALE

EMMA AND HOOK ARE PULLED INTO ZELENA’S TIME PORTAL AND FIND THEMSELVES IN
THE ENCHANTED FOREST OF THE PAST – BUT THEY MUST BE CAREFUL NOT TO CHANGE ANYTHING OR RISK ALTERING THE LIVES OF THEIR FRIENDS AND FAMILY, AS WELL AS THEIR VERY OWN EXISTENCE, ON THE TWO-HOUR SEASON FINALE OF ABC’S “ONCE UPON A TIME”


“Snow Drifts”/”There’s No Place Like Home” – While Mary Margaret and David celebrate the naming of their son at a coronation in Granny's Diner, Emma and Hook are pulled into Zelena's time portal and find themselves in the Enchanted Forest of the past. But in their quest to discover a way back, they must be careful not to change ANYTHING or risk altering the lives of their friends and family -- as well as their very own existence, on the two-hour season finale of “Once Upon a Time,” SUNDAY, MAY 11 (8:00-10:01 p.m., ET) on the ABC Television Network.

“Once Upon a Time” stars Ginnifer Goodwin as Snow White/Mary Margaret, Jennifer Morrison as Emma Swan, Lana Parrilla as the Evil Queen/Regina, Josh Dallas as Prince Charming/David, Emilie de Ravin as Belle, Colin O’Donoghue as Hook, Michael Raymond-James as Baelfire/Neal Cassidy, Jared S. Gilmore as Henry Mills and Robert Carlyle as Rumplestiltskin/Mr. Gold.

            Guest starring in “Snow Drifts” are Lee Arenberg as Leroy/Grumpy, Anastasia Griffith as Abigail/Kathryn, Tony Amendola as Geppetto, Meghan Ory as Ruby/Red, Alex Zahara as King Midas, Beverley Elliott as Granny, Rebecca Mader as Zelena, David-Paul Grove as Doc, Gabe Khouth as Sneezy, Faustino Di Bauda as Sleepy, Sean Maguire as Robin Hood, Christopher Gauthier as Smee and Charles Mesure as Black Beard.

            Guest starring in “There’s No Place Like Home” are Lee Arenberg as Leroy/Grumpy, Keegan Connor-Tracy as Blue Fairy/Mother Superior, Meghan Ory as Ruby/Red, Raphael Sbarge as Archie Hopper/Jiminy Cricket, Beverley Elliott as Granny, Sarah Bolger as Aurora, David-Paul Grove as Doc, Gabe Khouth as Sneezy, Faustino Di Bauda as Sleepy, Jeffrey Kaiser as Dopey, Mig Macario as Bashful, Sean Maguire as Robin Hood, Eric Keenleyside as Sir Maurice/Moe French and Raphael Alejandro as Roland.

            ”Snow Drifts” was written by David H. Goodman & Robert Hull and directed by Ron Underwood.

            ”There’s No Place Like Home” was written by Edward Kitsis & Adam Horowitz and directed by Ralph Hemecker.



“Once Upon a Time” is broadcast in 720 Progressive (720P), ABC’s selected HDTV format with a 5.1 channel surround sound. This program carries a TV-PG,V parental guideline.

For more information on “Once Upon a Time,” visit ABC.com/Once

Photography and video available at www.abcmedianet.com. Photography request line (818) 460-6611.

Follow us on:
            Facebook www.facebook.com/OnceABC
            Twitter @OnceABC, #OnceUponATime
@ABC_Publicity


Jeff Fordis (818) 460-6676 jeffrey.a.fordis@abc.com
Tra-Mi Callahan (818) 460-7967 tra-mi.callahan@abc.com
© 2014 American Broadcasting Companies, Inc.
All rights reserved.eserved.

Season Finale of Season 3 Promo 3x21 3x22

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com



All good things must come to an end, and the conclusion of Season Three of "Once Upon a Time" is, well, upon us.

The two-hour season finale of "Once Upon a Time," comprised of the two episodes "Snow Drifts" and "There's No Place Like Home," comes our way this Sunday, May 11, 2014.

"This past season we went from Neverland to Oz, the Big Apple back home to Storybrooke - 'It's like a fairytale' - all leading up to a spellbinding season finale. 'Aren't you a real prince charming.' So big - ' I got this!' - so grand - 'What have you done?' - so surprising - 'She dies tonight' - and, in the final minutes, find out where we're going to next - 'No! Noooooo!' - Once Upon a Time, two hour season finale starts next Sunday 8/7 Central on ABC."

There is certain to be a Season four. "Once Upon a Time" shows no signs of slowing down, now that it has carved out a secure niche for itself on Sunday nights and the programmers appear to have a handle on how to break up the seasons into two discrete parts.

Below are some promo shots from the two concluding episodes, including behind-the-scenes (green screen) shots.


Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com

Season Three Finale Once Upon a Time 3x21 3x22 onceuponatimeabc.filminspector.com
It looks like Lana Parrilla gets some hammy scenes in the finale


Thursday, May 1, 2014

3x20 - "Kansas" & "Wicked vs Evil" ABC Promos

onceuponatimeabc.filminspector.com
Rebecca Mader




"'What does a witch have to do to get your attention?' 'I just needed to find something to live for. Someone to destroy.' 'It's not exactly the welcome I was expecting.' 'You're... green.' 'And you're rude!' 'That's my dress.' 'Hmm, I had to take it in a little bit at the hips.' 'What the Hell did I ever do to you?' 'You were BORN!' 'Meet me on Main Street tonight, say, sundown.' 'This isn't the Wild West.' 'No, dear, it's the Wicked West.' 'Didn't anyone tell you? Black is my color.' 'But it looks so much better on me!' 'I'm going to take everything away from you.' 'Bring it!'"

We put this one up first - the official ABC promo for 3x20 is below - because it is an excellent promo, with just character dialogue. It is about as bitchy as you could come up with and a lot of fun.

Here's the official ABC promo for 3x20:



It was a rainy day on set, so we celebrate by a slew of pictures of the cast walking through the rain to work!

Once Upon a Time - Season 3 Promo "Wicked vs Evil"

onceuponatimeabc.filminspector.com
Josh Dallas and new arrival

onceuponatimeabc.filminspector.com

onceuponatimeabc.filminspector.com

onceuponatimeabc.filminspector.com

onceuponatimeabc.filminspector.com

onceuponatimeabc.filminspector.com

onceuponatimeabc.filminspector.com

onceuponatimeabc.filminspector.com